Buy FOXO4-DRI (10 mg)
FOXO4-DRI Peptide Description
FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids) |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358 g/mol |
| CAS Number | 2460055-10-9 |
| Synonyms | Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431 |
FOXO4-D-Retro-Inverso Structure
Source: Uniprot
Product Usage:
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.
FOXO4-DRI Research
FOXO4-DRI represents a promising therapeutic strategy for targeting senescent cells across various diseases, including cancer, pulmonary fibrosis, and age-related conditions. By selectively inducing apoptosis in senescent cells, FOXO4-DRI can restore tissue homeostasis and improve treatment outcomes. Further research is needed to fully understand its potential and optimize its application in clinical settings.
Applications in Cancer Treatment
FOXO4-DRI has been studied for its potential to enhance the radiosensitivity of non-small cell lung cancer (NSCLC) cells. By inducing apoptosis in senescent cancer-associated fibroblasts, FOXO4-DRI can reduce radioresistance in NSCLC, making cancer cells more susceptible to radiotherapy. This approach not only targets the tumor cells but also addresses the tumor microenvironment, which plays a crucial role in cancer progression and treatment resistance.1
Role in Pulmonary Fibrosis
In models of pulmonary fibrosis, FOXO4-DRI has been shown to decrease the number of senescent cells and reduce the expression of senescence-associated secretory phenotype (SASP) factors. This results in the attenuation of fibrosis-related morphological changes and collagen deposition, suggesting that FOXO4-DRI could serve as a viable therapeutic option for treating pulmonary fibrosis.2
Impact on Age-Related Conditions
FOXO4-DRI has demonstrated potential in alleviating age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. By promoting the apoptosis of these senescent cells, FOXO4-DRI improves the testicular microenvironment and restores testosterone levels, highlighting its potential in treating male late-onset hypogonadism.3
Effects on Cartilage Regeneration
In the context of cartilage regeneration, FOXO4-DRI has been used to selectively remove senescent cells from in vitro expanded human chondrocytes. While it effectively reduces the senescence level in these cells, its impact on enhancing chondrogenic potential and cartilage formation requires further investigation.4
References
- Zhao, Y., Zhang, J., & Han, X. (2019). FOXO4 D-retro-inverso peptide increases radiosensitivity of non-small cell lung cancer cells. Chinese journal of radiological medicine and protection, 39, 881-886. https://doi.org/10.3760/CMA.J.ISSN.0254-5098.2019.12.001.
- Han, X., Yuan, T., Zhang, J., Shi, Y., Li, D., Dong, Y., & Fan, S. (2022). FOXO4 peptide targets myofibroblast ameliorates bleomycin‐induced pulmonary fibrosis in mice through ECM‐receptor interaction pathway. Journal of Cellular and Molecular Medicine, 26, 3269 – 3280. https://doi.org/10.1111/jcmm.17333.
- Zhang, C., Xie, Y., Chen, H., Lv, L., Yao, J., Zhang, M., Xia, K., Feng, X., Li, Y., Liang, X., Sun, X., Deng, C., & Liu, G. (2020). FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. Aging (Albany NY), 12, 1272 – 1284. https://doi.org/10.18632/aging.102682.
- Huang, Y., He, Y., Makarcyzk, M., & Lin, H. (2021). Senolytic Peptide FOXO4-DRI Selectively Removes Senescent Cells From in vitro Expanded Human Chondrocytes. Frontiers in Bioengineering and Biotechnology, 9. https://doi.org/10.3389/fbioe.2021.677576.
FOXO4-DR1(251430)

FOX04(2502050022)
×
Disclaimer: For Research Purposes Only
This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use in humans. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides. . .




