Buy Tesamorelin and Ipamorelin (Blend) (8mg)

Tesamorelin and Ipamorelin Blend Product Description

The Tesamorelin/Ipamorelin blend combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.

This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).

Tesamorelin and Ipamorelin Peptide Structure

Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Synonyms:

• Tesamorelin acetate
• 901758-09-6
• TH9507
• UNII-LGW5H38VE3
• Tesamorelin acetate [USAN]

Ipamorelin

Sequence: Aib-His-D-2Nal-D-Phe-Lys

Molecular Formula: C₃₈H₄₉N₉O₅

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

CAS Number: 170851-70-4

Synonyms:

• 170851-70-4
• Ipamorelin [INN]
• NNC-26-0161
• UNII-Y9M3S784Z6

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Tesamorelin and Ipamorelin Research

Laboratory research on Tesamorelin and Ipamorelin reveals complementary mechanisms affecting growth hormone pathways. While each peptide stimulates GH release through different receptor interactions, their combined effects may extend beyond simple hormone elevation.

Current research demonstrates their individual influences on visceral fat reduction, muscle preservation, gastrointestinal function, and bone metabolism.

Effects on Growth Hormone Release

Tesamorelin is a GHRH analog that has been shown to augment basal and pulsatile GH secretion. It significantly increases IGF-1 levels. A study involving healthy subjects showed that tesamorelin treatment increased mean overnight GH, average log(10) GH peak area, and basal GH secretion¹.

Ipamorelin is a pentapeptide with distinct GH-releasing properties. It mimics ghrelin and binds to the ghrelin receptor (GHSR) in the brain, selectively stimulating GH release from the pituitary gland, which increases plasma GH levels. Ipamorelin’s GH release selectivity is similar to that of GHRH².

Lipolysis

Tesamorelin has demonstrated efficacy in reducing visceral adipose tissue (VAT) in HIV patients with lipodystrophy³. Studies have shown significant declines in VAT, hepatic fat, and trunk-to-appendicular fat ratio with tesamorelin treatment. It also reduces liver fat and improves liver enzymes⁴.

Ipamorelin stimulates appetite and enhances gastric motility. Research indicates it accelerates gastrointestinal transit and may ameliorate symptoms of postoperative ileus. In a rodent model, repetitive dosing of ipamorelin increased fecal pellet output, food intake, and body weight gain⁵.

Muscle Growth

Tesamorelin can increase skeletal muscle area and density. Among individuals with a clinically significant decrease in visceral adipose tissue, tesamorelin was effective in increasing the density of truncal muscle groups and the total area of the rectus and psoas muscles⁶.

In an adult rat model, ipamorelin counteracted the catabolic effects of glucocorticoids on skeletal muscles. Simultaneous administration of ipamorelin with glucocorticoids increased the maximum tetanic tension of calf muscles⁷.

Bone Density

Ipamorelin has been shown to increase bone mineral content (BMC) in young adult female rats. However, when corrected for body weight, total BMC was unaffected. The increase in cortical BMC was attributed to increased cross-sectional bone area, while cortical volumetric BMD remained unchanged⁸.

References

1. Stanley, T. L., Chen, C. Y., Branch, K. L., Makimura, H., & Grinspoon, S. K. (2011). Effects of a growth hormone-releasing hormone analog on endogenous GH pulsatility and insulin sensitivity in healthy men. The Journal of clinical endocrinology and metabolism, 96(1), 150–158. https://doi.org/10.1210/jc.2010-1587
2. Raun, K., Hansen, B. S., Johansen, N. L., Thøgersen, H., Madsen, K., Ankersen, M., & Andersen, P. H. (1998). Ipamorelin, the first selective growth hormone secretagogue. European journal of endocrinology, 139(5), 552–561. https://doi.org/10.1530/eje.0.1390552
3. Linda M. Spooner & J. L. Olin. (2012). Tesamorelin: A Growth Hormone-Releasing Factor Analogue for HIV-Associated Lipodystrophy. In Annals of Pharmacotherapy. https://doi.org/10.1345/aph.1Q629
4. Fourman, L.T., Czerwonka, N., Feldpausch, M.N., Weiss, J.J., Mamputu, J., Falutz, J.M., Morin, J., Marsolais, C., Stanley, T.L., & Grinspoon, S.K. (2017). Visceral fat reduction with tesamorelin is associated with improved liver enzymes in HIV. AIDS, 31, 2253–2259.
5. Venkova, K., Mann, W.R., Nelson, R.L., & Meerveld, B.G. (2009). Efficacy of Ipamorelin, a Novel Ghrelin Mimetic, in a Rodent Model of Postoperative Ileus. Journal of Pharmacology and Experimental Therapeutics, 329, 1110 – 1116. https://doi.org/10.1124/jpet.108.149211
6. Adrian, S., Scherzinger, A., Sanyal, A., Lake, J.E., Falutz, J., Dubé, M.P., Stanley, T.L., Grinspoon, S.K., Mamputu, J., Marsolais, C., Brown, T.T., & Erlandson, K.M. (2018). The Growth Hormone Releasing Hormone Analogue, Tesamorelin, Decreases Muscle Fat and Increases Muscle Area in Adults with HIV. The Journal of Frailty & Aging, 8, 154-159. https://doi.org/10.14283/jfa.2018.45
7. Andersen, N. B., Malmlöf, K., Johansen, P. B., Andreassen, T. T., Ørtoft, G., & Oxlund, H. (2001). The growth hormone secretagogue ipamorelin counteracts glucocorticoid-induced decrease in bone formation of adult rats. Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society, 11(5), 266–272. https://doi.org/10.1054/ghir.2001.0239
8. Svensson, J., Lall, S., Dickson, S. L., Bengtsson, B. A., Rømer, J., Ahnfelt-Rønne, I., Ohlsson, C., & Jansson, J. O. (2000). The GH secretagogues ipamorelin and GH-releasing peptide-6 increase bone mineral content in adult female rats. The Journal of endocrinology, 165(3), 569–577. https://doi.org/10.1677/joe.0.1650569

Tesamorelin/Ipamorelin (12020)

Tesamorelin / Ipamorelin (12020)

Tesamorelin / Ipamorelin (260264)

Endotoxin Tesamorelin/ Ipamorelin

Tesamorelin With Ipamorelin (251540)

Tesamorelin With Ipamorelin (251540E)

Tesamorelin/Ipamorelin (251446)

Tesamorelin/Ipamorelin (250967)

Tesamorelin / Ipamorelin COA10174 – Tesamorelin Component

Tesamorelin / Ipamorelin COA10174 – Ipamorelin Component

×

Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use in humans. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides. . .